VIMSS50374 has 108 amino acids
Query: DUF1376 [M=87]
Accession: PF07120.15
Description: Protein of unknown function (DUF1376)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.5e-40 121.3 0.8 1.1e-39 121.1 0.8 1.0 1 VIMSS50374
Domain annotation for each sequence (and alignments):
>> VIMSS50374
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 121.1 0.8 1.1e-39 1.1e-39 1 86 [. 8 91 .. 8 92 .. 0.99
Alignments for each domain:
== domain 1 score: 121.1 bits; conditional E-value: 1.1e-39
DUF1376 1 nYyphhigdyardtahLsalEhgaYllLldlyydtegplpdDdkrlarlagarteeeraaveavLaeffelsdggwvnarceeeia 86
nYy+++i++y+r+t+hLs+lEhg+Y+lLld+yy+te+p+p+D+ ++r+a+art++e++a + +L++ff+l+++gw+n+rc+e+ia
VIMSS50374 8 NYYRRNIDEYMRETKHLSPLEHGIYFLLLDHYYTTEKPIPADK--AYRFACARTKKEKNAADLILNTFFSLQEDGWHNKRCDEDIA 91
8*****************************************9..***************************************98 PP
Or compare VIMSS50374 to CDD or PaperBLAST