VIMSS513758 has 90 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.5e-30 89.7 4.6 7.6e-30 89.5 4.6 1.0 1 VIMSS513758
Domain annotation for each sequence (and alignments):
>> VIMSS513758
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.5 4.6 7.6e-30 7.6e-30 3 75 .. 14 83 .. 12 86 .. 0.96
Alignments for each domain:
== domain 1 score: 89.5 bits; conditional E-value: 7.6e-30
DUF4212 3 aYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrk 75
+Ywr+n+rli++lL++W+ ++f+ +++fa++l ++ f+g+p++Fw+aa g++l++++li++Yal+mnr D++
VIMSS513758 14 PYWRRNVRLIVLLLACWAGLTFV-PAYFARQL-AFD-FIGWPFSFWMAAYGAPLAYLILIVIYALVMNRFDAR 83
7**********************.********.895.**********************************86 PP
Or compare VIMSS513758 to CDD or PaperBLAST