VIMSS518057 has 66 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-29 87.2 7.6 3.6e-29 86.9 7.6 1.1 1 VIMSS518057
Domain annotation for each sequence (and alignments):
>> VIMSS518057
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.9 7.6 3.6e-29 3.6e-29 1 56 [] 4 59 .. 4 59 .. 0.99
Alignments for each domain:
== domain 1 score: 86.9 bits; conditional E-value: 3.6e-29
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
E++++Gvy+p+llv++++A++++ llrr larlglyr vWh++Lf++al+ ++lg+
VIMSS518057 4 EVNFYGVYFPSLLVMMVIAFAASSLLRRALARLGLYRAVWHRSLFNFALYLIVLGA 59
89****************************************************96 PP
Or compare VIMSS518057 to CDD or PaperBLAST