VIMSS5222208 has 295 amino acids
Query: DUF3298 [M=83]
Accession: PF11738.12
Description: Protein of unknown function (DUF3298)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.9e-20 58.4 0.7 1.9e-19 56.8 0.0 2.1 2 VIMSS5222208
Domain annotation for each sequence (and alignments):
>> VIMSS5222208
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.1 0.2 0.21 0.21 25 27 .. 94 96 .. 63 130 .. 0.45
2 ! 56.8 0.0 1.9e-19 1.9e-19 1 83 [] 189 267 .. 189 267 .. 0.94
Alignments for each domain:
== domain 1 score: -1.1 bits; conditional E-value: 0.21
DUF3298 25 qae 27
+++
VIMSS5222208 94 DKK 96
111 PP
== domain 2 score: 56.8 bits; conditional E-value: 1.9e-19
DUF3298 1 kDlFkpgsdylealselikkqlkkqaeeqeleeyeeleeefdaddisaydnFyltddglvfyfnpYeiaPyaaGaieftiPys 83
+Dl++p+ +++al++l+ +++k++ +++l++ ++ e +a+ ++ ++nF l d+gl++ + +Yei+Py++G ++++iPy+
VIMSS5222208 189 EDLLRPE--KKAALEKLAHEAFKAWVTDSKLANSVSEYE--QAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRLVIPYD 267
69*****..*****************9888777777777..9****************************************7 PP
Or compare VIMSS5222208 to CDD or PaperBLAST