PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS527431 to PF04269 (DUF440)

VIMSS527431 has 103 amino acids

Query:       DUF440  [M=101]
Accession:   PF04269.17
Description: Protein of unknown function, DUF440
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      3e-46  142.2   2.0    3.3e-46  142.1   2.0    1.0  1  VIMSS527431  


Domain annotation for each sequence (and alignments):
>> VIMSS527431  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.1   2.0   3.3e-46   3.3e-46       2     101 .]       4     103 .]       3     103 .] 0.98

  Alignments for each domain:
  == domain 1  score: 142.1 bits;  conditional E-value: 3.3e-46
       DUF440   2 ltedellekaydiFlelaadnLdpadillfnlefeerGaveevepeddWeeevgvevdkeefaevliGLeeeddelddiFarlLisrekeekechilW 99 
                  lt+de+++ aydiFle+a ++L+padillfnl+feerGave+ve++d Weee+g  +d+  faev++GL +++de+dd+Far+Lis++ e++e+h++W
  VIMSS527431   4 LTPDEAIDIAYDIFLEMAGEHLEPADILLFNLQFEERGAVEMVETSDRWEEEIGTLIDPTAFAEVWVGLVNDKDEMDDVFARFLISHQAENREYHVIW 101
                  799*********************************************************************************************** PP

       DUF440 100 kk 101
                  k+
  VIMSS527431 102 KE 103
                  96 PP



Or compare VIMSS527431 to CDD or PaperBLAST