VIMSS527761 has 111 amino acids
Query: DUF496 [M=93]
Accession: PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.2e-43 130.8 10.8 9.5e-43 130.6 10.8 1.0 1 VIMSS527761
Domain annotation for each sequence (and alignments):
>> VIMSS527761
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 130.6 10.8 9.5e-43 9.5e-43 1 91 [. 9 99 .. 9 101 .. 0.98
Alignments for each domain:
== domain 1 score: 130.6 bits; conditional E-value: 9.5e-43
DUF496 1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklk 91
++n+l++v+ r knkl+re dn++kirdn+krv ll+nl++yi+++ms+eei+aii+ m++dye+rvddy+i++aelsk+rre+++k+
VIMSS527761 9 FQNMLDYVHLYRLKNKLHRETADNDRKIRDNQKRVLLLDNLTQYITDAMSIEEIRAIIAHMRDDYENRVDDYMIRNAELSKQRREIRQKMA 99
69*************************************************************************************9985 PP
Or compare VIMSS527761 to CDD or PaperBLAST