VIMSS527761 has 111 amino acids
Query: DUF496 [M=93]
Accession: PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-45 137.9 11.1 5.5e-45 137.7 11.1 1.0 1 VIMSS527761
Domain annotation for each sequence (and alignments):
>> VIMSS527761
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 137.7 11.1 5.5e-45 5.5e-45 1 91 [. 9 99 .. 9 101 .. 0.98
Alignments for each domain:
== domain 1 score: 137.7 bits; conditional E-value: 5.5e-45
DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklk 91
++n+l++v+ +r knkl+re++dn++kirdnqkrv+ll+nl++yi+++msieei+aii++m++dye+rvddy+i+naelsk+rre+++k+
VIMSS527761 9 FQNMLDYVHLYRLKNKLHRETADNDRKIRDNQKRVLLLDNLTQYITDAMSIEEIRAIIAHMRDDYENRVDDYMIRNAELSKQRREIRQKMA 99
689*************************************************************************************996 PP
Or compare VIMSS527761 to CDD or PaperBLAST