VIMSS528248 has 130 amino acids
Query: DUF454 [M=115] Accession: PF04304.18 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-43 134.1 3.5 1.3e-43 133.9 3.5 1.0 1 VIMSS528248 Domain annotation for each sequence (and alignments): >> VIMSS528248 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 133.9 3.5 1.3e-43 1.3e-43 1 113 [. 2 115 .. 2 117 .. 0.97 Alignments for each domain: == domain 1 score: 133.9 bits; conditional E-value: 1.3e-43 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlaafcfarssprlhrwLlehklfgpyirdwrekraiplkaKvialllmllsllislllveslwvkil 98 +ll+++lG+l+++lG+iG+v+P+LPTtpFlLla fcf++ssprl++w+++ kl+++y++d+ ekra+++k+Kv++ll+ + + ++s+++ +++w k + VIMSS528248 2 KLLYITLGFLAIGLGIIGVVVPGLPTTPFLLLALFCFSKSSPRLQQWFMRGKLYQKYLKDYDEKRAMTMKQKVCILLISTPFSILSFFTLPNIWGKSA 99 689*********************************************************************************************** PP DUF454 99 lllvlllvllyl.lrl 113 ll+++++ ++y+ +++ VIMSS528248 100 LLALVVCQYWYFlCKM 115 ***********96665 PP
Or compare VIMSS528248 to CDD or PaperBLAST