VIMSS52961 has 68 amino acids
Query: DUF2065 [M=56]
Accession: PF09838.13
Description: Uncharacterized protein conserved in bacteria (DUF2065)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-26 78.5 4.1 2e-26 78.2 4.1 1.1 1 VIMSS52961
Domain annotation for each sequence (and alignments):
>> VIMSS52961
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.2 4.1 2e-26 2e-26 1 55 [. 11 65 .. 11 66 .. 0.98
Alignments for each domain:
== domain 1 score: 78.2 bits; conditional E-value: 2e-26
DUF2065 1 LllAlGLvLviEGllpflaPerwrrmlaqlaelpdgqLRliGlvsmllGllllwl 55
L++AlGLvL++EGl p+ aP+ wr+m+aql+ +pd+qLR+iG++++++G+++ ++
VIMSS52961 11 LWVALGLVLIVEGLGPLFAPRGWRQMVAQLSLQPDNQLRRIGGCLVVAGAVIAYV 65
89**************************************************997 PP
Or compare VIMSS52961 to CDD or PaperBLAST