VIMSS53077 has 187 amino acids
Query: DUF179 [M=157] Accession: PF02622.19 Description: Uncharacterized ACR, COG1678 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-58 183.6 0.0 1.5e-58 183.4 0.0 1.0 1 VIMSS53077 Domain annotation for each sequence (and alignments): >> VIMSS53077 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 183.4 0.0 1.5e-58 1.5e-58 1 157 [] 12 174 .. 12 174 .. 0.94 Alignments for each domain: == domain 1 score: 183.4 bits; conditional E-value: 1.5e-58 DUF179 1 PsledpnFersVvllcehneegamGlvlNrpleltlkelleelleleaepaae.e.....pvylGGPveqdrlfvlhsle..lessleisdglyltgsl 91 Ps++dp+F+rsV+++cehn++gamGl++N p+++t++ +l++ +++e + ++ + pv++GGPv++dr+f+lh+ + +ess++++d++++t+s+ VIMSS53077 12 PSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQ-VDIEPAYPQShQenlkkPVFNGGPVSEDRGFILHRPRdhYESSMKMTDDIAVTTSK 109 89****************************************.67776655543479*********************44679**************** PP DUF179 92 dilealaggagpeklrvflGyagWgagQLeeEieenaWlvvpasdeellfetppeelWeealrrlG 157 dil l ++a+pe ++v+lGy+gW+agQLe E+ en+Wl+++a d+el+f+tp +e+W++a+++lG VIMSS53077 110 DILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEA-DPELIFNTPVHEKWQKAIQKLG 174 *******************************************.888*****************99 PP
Or compare VIMSS53077 to CDD or PaperBLAST