VIMSS531368 has 510 amino acids
Query: DUF5060 [M=70] Accession: PF16586.11 Description: Domain of unknown function (DUF5060) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-28 84.2 1.2 5.8e-28 83.3 0.2 2.1 2 VIMSS531368 Domain annotation for each sequence (and alignments): >> VIMSS531368 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.3 0.2 5.8e-28 5.8e-28 1 70 [] 3 70 .. 3 70 .. 0.97 2 ? -3.5 0.1 0.75 0.75 19 46 .. 283 310 .. 272 317 .. 0.64 Alignments for each domain: == domain 1 score: 83.3 bits; conditional E-value: 5.8e-28 EEETTS-EEEEEE.---SS-GG.G--EEEEEEET.TEEEEEE-EE-STTEEEEEE---S-EEEEEEEEES CS DUF5060 1 evekWekveltfkaeseyanPftdvelsatFthpsgesitvpGFydGdgayrvrFaPdeeGewtYktssn 70 evekW+++elt+++++ +nPf dvelsatF + ++sitv+GFydGdg+y++r++P+ eGe+t +t+sn VIMSS531368 3 EVEKWKRYELTLDGPTD-GNPFRDVELSATFDRN-NHSITVDGFYDGDGKYKIRYMPEVEGEYTVTTHSN 70 69***********9999.****************.********************************986 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 S-GG.G--EEEEEEET.TEEEEEE-EE- CS DUF5060 19 anPftdvelsatFthpsgesitvpGFyd 46 ++P ++ e +F p +++ t++ +yd VIMSS531368 283 KDPSQHLESIHNFYDPPQHKDTTKNWYD 310 4566666666666666666666666665 PP
Or compare VIMSS531368 to CDD or PaperBLAST