VIMSS531368 has 510 amino acids
Query: DUF5060 [M=70]
Accession: PF16586.9
Description: Domain of unknown function (DUF5060)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-29 88.5 0.2 5e-29 86.7 0.2 2.0 1 VIMSS531368
Domain annotation for each sequence (and alignments):
>> VIMSS531368
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.7 0.2 5e-29 5e-29 1 70 [] 3 70 .. 3 70 .. 0.98
Alignments for each domain:
== domain 1 score: 86.7 bits; conditional E-value: 5e-29
DUF5060 1 evekWevveltlkaeseyanPftdvelsatFthesgrsitvpGFydGdgayrvrFmPdeeGewtYktssn 70
evekW+++eltl+++++ +nPf+dvelsatF + ++sitv+GFydGdg+y++r+mP+ eGe+t +t+sn
VIMSS531368 3 EVEKWKRYELTLDGPTD-GNPFRDVELSATFDRN-NHSITVDGFYDGDGKYKIRYMPEVEGEYTVTTHSN 70
69***********9999.****************.********************************996 PP
Or compare VIMSS531368 to CDD or PaperBLAST