VIMSS532771 has 96 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-23 69.0 0.6 2.2e-23 68.8 0.6 1.1 1 VIMSS532771
Domain annotation for each sequence (and alignments):
>> VIMSS532771
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 68.8 0.6 2.2e-23 2.2e-23 1 79 [] 13 91 .. 13 91 .. 0.99
Alignments for each domain:
== domain 1 score: 68.8 bits; conditional E-value: 2.2e-23
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
Rk+I+eiD++l+eL+aeR+++a eia++Kk+ g v+dp+Re+++ e+ r e+++++pe++ k+++ ++ + +++Qk
VIMSS532771 13 RKRINEIDEQLIELIAERTSFAPEIAALKKSLGTCVFDPKREDAICEKTRLMCEKHHIEPEVALKVMKILMTYNKEVQK 91
9***************************************************************************996 PP
Or compare VIMSS532771 to CDD or PaperBLAST