VIMSS536721 has 161 amino acids
Query: DUF732 [M=72]
Accession: PF05305.19
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-23 67.9 0.3 6.2e-23 67.4 0.3 1.2 1 VIMSS536721
Domain annotation for each sequence (and alignments):
>> VIMSS536721
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.4 0.3 6.2e-23 6.2e-23 1 72 [] 73 144 .. 73 144 .. 0.98
Alignments for each domain:
== domain 1 score: 67.4 bits; conditional E-value: 6.2e-23
DUF732 1 addaFlaaLdsagvsypdddaaiaaGkqvCaaLdaGkspedvaaallasnpglteaqagffvgaAiaayCPq 72
+d++Fl+ L++ag++y+d+ +ai +Gk+vC+ Ld+G+s + ++++l+++np ++ a a+ f +++a+yCP+
VIMSS536721 73 NDQDFLKDLRDAGITYQDAGNAITIGKSVCELLDDGQSDAKIVTDLRNQNPAFQGASAAKFTYLSAAHYCPK 144
69*********************************************************************5 PP
Or compare VIMSS536721 to CDD or PaperBLAST