VIMSS536722 has 114 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-25 74.5 1.5 5.5e-25 74.0 1.5 1.2 1 VIMSS536722
Domain annotation for each sequence (and alignments):
>> VIMSS536722
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.0 1.5 5.5e-25 5.5e-25 2 72 .] 26 96 .. 25 96 .. 0.99
Alignments for each domain:
== domain 1 score: 74.0 bits; conditional E-value: 5.5e-25
DUF732 2 DdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
DdaF+a Ld+aG++y+d+d+a +aG++vC+ L+ Gk+ +dv+++l+++n++l++d+a +f+++A++ayCP+
VIMSS536722 26 DDAFVASLDKAGIKYGDADKAAGAGKWVCTTLQGGKQMSDVVSTLQSKNSNLSDDHANTFAAIAVNAYCPD 96
9*********************************************************************7 PP
Or compare VIMSS536722 to CDD or PaperBLAST