VIMSS540150 has 118 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-23 69.3 3.8 2.6e-23 68.6 3.8 1.3 1 VIMSS540150
Domain annotation for each sequence (and alignments):
>> VIMSS540150
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 68.6 3.8 2.6e-23 2.6e-23 1 72 [] 40 111 .. 40 111 .. 0.98
Alignments for each domain:
== domain 1 score: 68.6 bits; conditional E-value: 2.6e-23
DUF732 1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
+D+aFlaaLdqaG+ty+dp +ai a++++C ++G++ +++a+l+++npglt d aa f+++A ayCP+
VIMSS540150 40 DDAAFLAALDQAGITYADPGHAITAAKAMCGLCANGVTGLQLVADLRDYNPGLTMDSAAKFAAIASGAYCPE 111
6999*******************************************************************7 PP
Or compare VIMSS540150 to CDD or PaperBLAST