VIMSS5432735 has 157 amino acids
Query: DUF494 [M=153] Accession: PF04361.17 Description: Protein of unknown function (DUF494) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-64 202.2 3.5 2.2e-64 202.1 3.5 1.0 1 VIMSS5432735 Domain annotation for each sequence (and alignments): >> VIMSS5432735 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.1 3.5 2.2e-64 2.2e-64 1 153 [] 1 156 [. 1 156 [. 0.97 Alignments for each domain: == domain 1 score: 202.1 bits; conditional E-value: 2.2e-64 DUF494 1 mfdvLvYLfenyi..eaealpdedeLeeeLsaaGFeeeeIkkAldwleeLaalqeeeeeaal.aessslRiyteeEqekLdaeargfllfLeqagvl 94 mfd+L+YLfeny+ e e l+dedeL++eL++aGF+++eI kAl+wle+La+lqe + ++++s+Riyt++E+e++d+e+rgfllfLeq++vl VIMSS5432735 1 MFDILMYLFENYVhsEVEFLVDEDELTKELTRAGFHQAEIIKALTWLEGLAELQEAGTPYLCnHDQQSFRIYTKDELERIDVESRGFLLFLEQIKVL 97 9************9899999**********************************9988665579********************************* PP DUF494 95 daetrElvidramaldeeeisledlkwvvlmvlfnqpgeekallileellldeeeellh 153 + etrE+vidr+m+lde++++l+dlkwv+lmvlfn pg+e+a++++e+l++++ +++lh VIMSS5432735 98 SVETREMVIDRVMQLDESSLNLDDLKWVILMVLFNAPGHESAYEQMEDLIFEQPDGRLH 156 ******************************************************99998 PP
Or compare VIMSS5432735 to CDD or PaperBLAST