VIMSS5436346 has 658 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.7e-21 60.5 2.8 1.9e-20 59.4 2.8 1.6 1 VIMSS5436346
Domain annotation for each sequence (and alignments):
>> VIMSS5436346
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.4 2.8 1.9e-20 1.9e-20 1 79 [] 11 89 .. 11 89 .. 0.96
Alignments for each domain:
== domain 1 score: 59.4 bits; conditional E-value: 1.9e-20
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R++I +D++ll+Lla+R el+ ++a+ K+ p++d+ Re+e+l+rl ++ +e+gld+++v ++++ ii+ s+ Q+
VIMSS5436346 11 REQITTLDNDLLALLAKRRELSLDVARSKEVDIRPIRDTIREKELLARLVKQGREQGLDAHYVISLYQSIIEDSVLNQQ 89
9****************************76666****************************************98885 PP
Or compare VIMSS5436346 to CDD or PaperBLAST