VIMSS544202 has 591 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-14 40.3 7.7 1.8e-14 40.2 5.4 2.4 2 VIMSS544202 Domain annotation for each sequence (and alignments): >> VIMSS544202 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.2 5.4 1.8e-14 1.8e-14 1 78 [. 244 321 .. 244 322 .. 0.98 2 ? -2.2 0.0 0.31 0.31 7 30 .. 557 580 .. 555 586 .. 0.76 Alignments for each domain: == domain 1 score: 40.2 bits; conditional E-value: 1.8e-14 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78 Rk+I iD+ +l+L++ R +lak+i e+K+ ++lp+ d++ e e+ + l e a+e++l+p ++ ++++ +is+ ++++ VIMSS544202 244 RKQIMVIDKLILDLIKIRNDLAKQIKEIKELRNLPIEDKKWEIEKRNILLEFAKERELNPLYTDQLIELLISWAKHIE 321 9************************************************************************99987 PP == domain 2 score: -2.2 bits; conditional E-value: 0.31 CM_2 7 iDrelleLlaeRmelakeiaeyKk 30 +++++le + ++ +k +++++ VIMSS544202 557 LNNKILEEIRAKANWVKHLGNFRE 580 788899999999999998888875 PP
Or compare VIMSS544202 to CDD or PaperBLAST