VIMSS548718 has 385 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-20 59.3 1.7 4.8e-20 58.1 1.7 1.7 1 VIMSS548718
Domain annotation for each sequence (and alignments):
>> VIMSS548718
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.1 1.7 4.8e-20 4.8e-20 1 79 [] 10 88 .. 10 88 .. 0.98
Alignments for each domain:
== domain 1 score: 58.1 bits; conditional E-value: 4.8e-20
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+++ e+D +ll LlaeR +la +ia+ K + + p++d++Re+e+l+ l ++ +++gld ++ ++f+ ii+ s+ Q+
VIMSS548718 10 REKVSELDLKLLILLAERRQLAFDIAQTKLQDNRPIRDKDRERELLDVLIKKGKSYGLDGFYISRLFQMIIEDSVLTQQ 88
999************************************************999********************99985 PP
Or compare VIMSS548718 to CDD or PaperBLAST