VIMSS5488823 has 55 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.12
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-25 75.2 0.9 1.5e-25 75.0 0.9 1.0 1 VIMSS5488823
Domain annotation for each sequence (and alignments):
>> VIMSS5488823
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.0 0.9 1.5e-25 1.5e-25 2 45 .. 5 48 .. 4 49 .. 0.97
Alignments for each domain:
== domain 1 score: 75.0 bits; conditional E-value: 1.5e-25
DUF2635 2 kPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvke 45
kP++Gl VRdPet+q+L+++Gee+pr++yWlRRlk+G+V +vk+
VIMSS5488823 5 KPVKGLLVRDPETRQPLKKTGEEKPRNIYWLRRLKEGSVGIVKT 48
9*****************************************97 PP
Or compare VIMSS5488823 to CDD or PaperBLAST