VIMSS55287 has 88 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-40 121.4 5.5 9.3e-40 121.3 5.5 1.0 1 VIMSS55287
Domain annotation for each sequence (and alignments):
>> VIMSS55287
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 121.3 5.5 9.3e-40 9.3e-40 1 78 [. 9 85 .. 9 86 .. 0.98
Alignments for each domain:
== domain 1 score: 121.3 bits; conditional E-value: 9.3e-40
DUF4212 1 akaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygv 78
a+aYw++nl ++ lL++Wflvsfg+gilf+++lnti+ f+gf+lgFwfa+qgsi++fv+lifvY+ rmn+lD+ky+v
VIMSS55287 9 AQAYWKENLGIMGSLLAVWFLVSFGAGILFVDALNTIE-FAGFKLGFWFAQQGSIYTFVALIFVYVARMNALDKKYNV 85
589**********************************6.*************************************98 PP
Or compare VIMSS55287 to CDD or PaperBLAST