VIMSS55339 has 210 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-17 48.3 0.0 6.6e-17 47.5 0.0 1.4 1 VIMSS55339
Domain annotation for each sequence (and alignments):
>> VIMSS55339
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 47.5 0.0 6.6e-17 6.6e-17 1 55 [. 143 197 .. 143 198 .. 0.97
Alignments for each domain:
== domain 1 score: 47.5 bits; conditional E-value: 6.6e-17
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsG 55
lt+dYa +++l ++++qf+at ++++Y ++V+++ve+++ + +af+qaL++ +++
VIMSS55339 143 LTLDYAMIPLLHSIMAQFSATEMEAHYNEQVEMVVELEALQSDAFTQALINKSGA 197
79*************************************************9976 PP
Or compare VIMSS55339 to CDD or PaperBLAST