VIMSS5546614 has 99 amino acids
Query: DUF3046 [M=62]
Accession: PF11248.12
Description: Protein of unknown function (DUF3046)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.2e-29 86.1 0.3 1e-28 85.8 0.3 1.1 1 VIMSS5546614
Domain annotation for each sequence (and alignments):
>> VIMSS5546614
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.8 0.3 1e-28 1e-28 1 61 [. 23 83 .. 23 84 .. 0.99
Alignments for each domain:
== domain 1 score: 85.8 bits; conditional E-value: 1e-28
DUF3046 1 MRlteFwelveeeFGsayaeslardhvlselggrTaeeAleaGvdprdVWralcdafdvPe 61
MR++eFwel+ee+FG++y++sl rd+ + +l ++T+ eAl+aG++pr VW+ lcd+++vP+
VIMSS5546614 23 MREREFWELLEEVFGRTYGRSLSRDQRMPKLANMTVVEALDAGEEPRVVWNVLCDQMEVPD 83
************************************************************8 PP
Or compare VIMSS5546614 to CDD or PaperBLAST