VIMSS55776 has 77 amino acids
Query: DUF1289 [M=48] Accession: PF06945.17 Description: Protein of unknown function (DUF1289) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-21 62.3 8.1 1.5e-21 62.3 8.1 1.5 2 VIMSS55776 Domain annotation for each sequence (and alignments): >> VIMSS55776 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.37 0.37 7 13 .. 3 9 .. 2 11 .. 0.63 2 ! 62.3 8.1 1.5e-21 1.5e-21 1 47 [. 24 69 .. 24 70 .. 0.97 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.37 DUF1289 7 Ckldaed 13 C++++++ VIMSS55776 3 CTMSENQ 9 7777554 PP == domain 2 score: 62.3 bits; conditional E-value: 1.5e-21 DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47 sPC+++C+ld ++++C+GCgRt+dEi++Ws++++ e++++l ++ +r VIMSS55776 24 SPCVRHCCLD-DKDICIGCGRTIDEICRWSSATNSEKQEILINCLAR 69 9*********.******************************999887 PP
Or compare VIMSS55776 to CDD or PaperBLAST