VIMSS56084 has 106 amino acids
Query: DUF496 [M=93]
Accession: PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-49 151.8 12.8 2.7e-49 151.6 12.8 1.0 1 VIMSS56084
Domain annotation for each sequence (and alignments):
>> VIMSS56084
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 151.6 12.8 2.7e-49 2.7e-49 1 93 [] 1 93 [. 1 93 [. 0.99
Alignments for each domain:
== domain 1 score: 151.6 bits; conditional E-value: 2.7e-49
DUF496 1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklkel 93
+n+v+e+v+ arrknkl+re++dnekk+rdnrkrvell nll+yikpnms+eei ii+nmksdyedrvdd+iiksae+skerr++s+++k+l
VIMSS56084 1 MNSVFEIVSLARRKNKLQRELDDNEKKVRDNRKRVELLVNLLDYIKPNMSHEEILGIIKNMKSDYEDRVDDHIIKSAEISKERRDISRRIKDL 93
89*****************************************************************************************86 PP
Or compare VIMSS56084 to CDD or PaperBLAST