VIMSS56361 has 119 amino acids
Query: DUF413 [M=90]
Accession: PF04219.16
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-39 120.6 0.2 1.4e-39 120.3 0.2 1.1 1 VIMSS56361
Domain annotation for each sequence (and alignments):
>> VIMSS56361
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.3 0.2 1.4e-39 1.4e-39 1 90 [] 12 101 .. 12 101 .. 0.99
Alignments for each domain:
== domain 1 score: 120.3 bits; conditional E-value: 1.4e-39
DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgtkk 90
rF+D+k+fprGf++sGdFt++e+++L++yG+++ +Le+gel+p++++e++f++v+ + + ae++lek+WlkY++l+rg+krfhtl+g++k
VIMSS56361 12 RFFDTKKFPRGFAKSGDFTLAEEDILTRYGDTMLGLESGELQPENADEEHFLKVLANPELAENKLEKAWLKYTRLARGRKRFHTLNGRNK 101
8*************************************************************************************9975 PP
Or compare VIMSS56361 to CDD or PaperBLAST