VIMSS565954 has 112 amino acids
Query: DUF760 [M=83] Accession: PF05542.16 Description: Protein of unknown function (DUF760) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-35 108.3 0.8 1.2e-35 108.0 0.8 1.1 1 VIMSS565954 Domain annotation for each sequence (and alignments): >> VIMSS565954 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.0 0.8 1.2e-35 1.2e-35 1 83 [] 19 101 .. 19 101 .. 0.99 Alignments for each domain: == domain 1 score: 108.0 bits; conditional E-value: 1.2e-35 DUF760 1 eLlryiqslkpeevkalskpaspevleaikqtvsgllgllpsesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeksl 83 +L++y+q+++pe +++++k+as++++e+i+++v+gllg+lps++f+v i+ s++++a+Ll s+mmtGYfLr++eqR eLe++l VIMSS565954 19 DLIQYLQKQSPEVMQRVAKSASEDIQEIIRHNVQGLLGMLPSDQFDVKITSSKDNIANLLSSAMMTGYFLRQMEQRKELEQTL 101 699*****************************************************************************987 PP
Or compare VIMSS565954 to CDD or PaperBLAST