VIMSS566230 has 1186 amino acids
Query: Met_synt_B12 [M=273] Accession: PF02965.22 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-36 109.9 0.0 1.3e-35 109.2 0.0 1.3 1 VIMSS566230 Domain annotation for each sequence (and alignments): >> VIMSS566230 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.2 0.0 1.3e-35 1.3e-35 4 256 .. 940 1185 .. 937 1186 .] 0.85 Alignments for each domain: == domain 1 score: 109.2 bits; conditional E-value: 1.3e-35 Met_synt_B12 4 elveyidWtpffq.awelkgkypkiledekvgeeakklfkdAqamLkkii....eekllkakavvglfpansvgddievyadesrseelatlhtL 93 +l+ y+d + f+ w++k + + ++v+e + l + A+ +L+k+i ++ l++ k v+g f + ++++ i ++ d+ +++++ ++++ VIMSS566230 940 KLIFYLDKKALFSgQWQIKKN-----KGQSVEEYNNYLDSYANPLLEKWIniilDKGLISPKVVYGYFRCGRNDNSIYLF-DNVSNKRISEFNFP 1028 666677776666436777776.....556666777777777888887654222268999********************8.6666788999**** PP Met_synt_B12 94 rqqaekeegepnlclaDfvapke.sgvkDyiGlfavtaglgieelakefeaeeDdYsa.ilvkalaDrLaeAfaellhekvrkelWgyakdekls 186 rq+ + +nlc+aDf + + ++ D + + avt+g ++e+ +e+ ++ D+Ys+ ++++ l+ LaeA+ae++h+ vr e g+++ e + VIMSS566230 1029 RQK-----SGNNLCIADFYCDLKnNDPVDIFPMQAVTMGEIASEYSQELFKA-DKYSDyLIFHGLTVQLAEALAEYVHSIVRIE-CGFKSYEPNN 1116 *99.....4579*****98775505568999999*****9999999999888.99987367899******************99.8********* PP Met_synt_B12 187 neelikekYqGiRpApGYpacpdhsekktlfelldaeekigieLteslamtPaasvsGlyfahpeskyFa 256 n++++++kY+G R+++GYpacp+ s ++ +lld+++ i++++ es ++P++s +++ h ++kyF+ VIMSS566230 1117 NRDILAQKYRGARYSFGYPACPKVSDSNIQLSLLDTKR-INLTMDESEQLHPEQSTTAIISLHSKAKYFS 1185 ************************************99.******************************7 PP
Or compare VIMSS566230 to CDD or PaperBLAST