VIMSS56856 has 189 amino acids
Query: DUF179 [M=157] Accession: PF02622.19 Description: Uncharacterized ACR, COG1678 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-54 170.3 0.0 1.9e-54 170.1 0.0 1.0 1 VIMSS56856 Domain annotation for each sequence (and alignments): >> VIMSS56856 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 170.1 0.0 1.9e-54 1.9e-54 1 157 [] 18 176 .. 18 176 .. 0.93 Alignments for each domain: == domain 1 score: 170.1 bits; conditional E-value: 1.9e-54 DUF179 1 PsledpnFersVvllcehneegamGlvlNrpleltlkelleelleleaepaaee..pvylGGPveqdrlfvlhsle..lessleisdglyltgsldile 95 P++ dpnF+++V++l+ehne+gamGlv+Nrp++l+l+e+le+l + +pa+ + +y+GGPv++dr+fvlh + ++s+le+ +l++++s+d+l VIMSS56856 18 PHMADPNFAQTVTYLVEHNEQGAMGLVINRPSGLNLAEVLEQLKPDALPPARCQhiDIYNGGPVQTDRGFVLHPSGlsYQSTLELG-ELAMSTSQDVLF 115 99****************************************65555554444468******************666789999998.9*********** PP DUF179 96 alaggagpeklrvflGyagWgagQLeeEieenaWlvvpasdeellfetppeelWeealrrlG 157 a+a g+gpek ++ lGyagW+agQLe+E+++naWl++pa d+++lf+ ppee+ ++a++rlG VIMSS56856 116 AIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPA-DPAILFDLPPEERLSAAAARLG 176 ***************************************.888****************998 PP
Or compare VIMSS56856 to CDD or PaperBLAST