VIMSS56993 has 139 amino acids
Query: DUF1090 [M=110]
Accession: PF06476.17
Description: Protein of unknown function (DUF1090)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5e-41 125.4 8.5 6.7e-41 125.0 8.5 1.1 1 VIMSS56993
Domain annotation for each sequence (and alignments):
>> VIMSS56993
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 125.0 8.5 6.7e-41 6.7e-41 3 110 .] 21 128 .. 19 128 .. 0.97
Alignments for each domain:
== domain 1 score: 125.0 bits; conditional E-value: 6.7e-41
DUF1090 3 llsllaaaaaaalsgCaaKaqaiekqlseAkahgnkarvagLekALaevkahCtdaglleereakveekeeeVaereaeLkeakekgdadkiakrkkkL 101
+++ + aa+ a lsgCaaK++aie++l++A++ n+ +vagLekAL+evk+hCt+agll+e+++kv ++e+eV+ere++L++a+ kgd++ki+krk+kL
VIMSS56993 21 SAAQPGAAKGAPLSGCAAKQAAIEAKLETARSFANEGQVAGLEKALSEVKEHCTEAGLLRENKQKVIDSEREVSEREKDLRKAMGKGDPEKIEKRKAKL 119
677888999****************************************************************************************** PP
DUF1090 102 aeareeLke 110
aear+eL+e
VIMSS56993 120 AEARAELEE 128
*******86 PP
Or compare VIMSS56993 to CDD or PaperBLAST