PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS572274 to PF04430 (DUF498)

VIMSS572274 has 127 amino acids

Query:       DUF498  [M=109]
Accession:   PF04430.18
Description: Protein of unknown function (DUF498/DUF598)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.2e-33   99.9   0.0    4.8e-33   99.7   0.0    1.0  1  VIMSS572274  


Domain annotation for each sequence (and alignments):
>> VIMSS572274  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.7   0.0   4.8e-33   4.8e-33       1     109 []      16     124 ..      16     124 .. 0.97

  Alignments for each domain:
  == domain 1  score: 99.7 bits;  conditional E-value: 4.8e-33
       DUF498   1 idgygeggfrvngkkyegsllvlpgevfawevakaedlteeslallellepkpevlilGtGarlrflppelrealkergigvevmdtraAcrtyNvla 98 
                  id+yg+ggf +++++++gsll+lp+ v+ w+v+k+e++++ sl+ +    + +++li+GtGa+++  p++lreal+  ++ +++m+t+ A+rtyN+++
  VIMSS572274  16 IDAYGKGGFYFADMSHQGSLLFLPDAVWGWDVTKPEQIDRYSLQRVFDNANAIDTLIVGTGADVWIAPRQLREALRGVNVVLDTMQTGPAIRTYNIMI 113
                  89*****************************999************445788********************************************** PP

       DUF498  99 segrrvaaaLi 109
                  +e+rrvaaaLi
  VIMSS572274 114 GERRRVAAALI 124
                  **********8 PP



Or compare VIMSS572274 to CDD or PaperBLAST