VIMSS572274 has 127 amino acids
Query: DUF498 [M=109] Accession: PF04430.18 Description: Protein of unknown function (DUF498/DUF598) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-33 99.9 0.0 4.8e-33 99.7 0.0 1.0 1 VIMSS572274 Domain annotation for each sequence (and alignments): >> VIMSS572274 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.7 0.0 4.8e-33 4.8e-33 1 109 [] 16 124 .. 16 124 .. 0.97 Alignments for each domain: == domain 1 score: 99.7 bits; conditional E-value: 4.8e-33 DUF498 1 idgygeggfrvngkkyegsllvlpgevfawevakaedlteeslallellepkpevlilGtGarlrflppelrealkergigvevmdtraAcrtyNvla 98 id+yg+ggf +++++++gsll+lp+ v+ w+v+k+e++++ sl+ + + +++li+GtGa+++ p++lreal+ ++ +++m+t+ A+rtyN+++ VIMSS572274 16 IDAYGKGGFYFADMSHQGSLLFLPDAVWGWDVTKPEQIDRYSLQRVFDNANAIDTLIVGTGADVWIAPRQLREALRGVNVVLDTMQTGPAIRTYNIMI 113 89*****************************999************445788********************************************** PP DUF498 99 segrrvaaaLi 109 +e+rrvaaaLi VIMSS572274 114 GERRRVAAALI 124 **********8 PP
Or compare VIMSS572274 to CDD or PaperBLAST