VIMSS5750406 has 185 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-15 44.1 0.3 3.1e-15 42.7 0.1 1.8 2 VIMSS5750406 Domain annotation for each sequence (and alignments): >> VIMSS5750406 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.7 0.1 3.1e-15 3.1e-15 12 79 .] 36 103 .. 33 103 .. 0.96 2 ? -1.5 0.0 0.18 0.18 1 15 [. 126 140 .. 126 150 .. 0.77 Alignments for each domain: == domain 1 score: 42.7 bits; conditional E-value: 3.1e-15 CM_2 12 leLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 +L++eR++++k++a yK+e++lp+ d +e++vl++ ++a++ gl+ e+v+ ++ + ++ +a+Q+ VIMSS5750406 36 ARLINERLSYMKDVAGYKAEQHLPIEDLTQEKKVLDQSLSEADSFGLNSETVKPFIVAQMDVAKAIQY 103 68***************************************************************996 PP == domain 2 score: -1.5 bits; conditional E-value: 0.18 CM_2 1 RkeIdeiDrelleLl 15 R +I +++ ell+ + VIMSS5750406 126 RLKISALNTELLKNI 140 667888888888765 PP
Or compare VIMSS5750406 to CDD or PaperBLAST