VIMSS5767391 has 137 amino acids
Query: DUF559 [M=109] Accession: PF04480.16 Description: Protein of unknown function (DUF559) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-10 27.3 0.1 1.6e-09 23.9 0.0 2.1 2 VIMSS5767391 Domain annotation for each sequence (and alignments): >> VIMSS5767391 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.5 0.0 0.014 0.014 47 67 .. 50 70 .. 27 87 .. 0.76 2 ! 23.9 0.0 1.6e-09 1.6e-09 67 108 .. 93 134 .. 73 135 .. 0.88 Alignments for each domain: == domain 1 score: 1.5 bits; conditional E-value: 0.014 DUF559 47 DfvclkaklivelDGaqhdee 67 Df +k k+ v +DG +++ VIMSS5767391 50 DFSFKKYKVAVFVDGEFWHGK 70 9999999*******9865543 PP == domain 2 score: 23.9 bits; conditional E-value: 1.6e-09 DUF559 67 eeeyDaeRtelLeslGftvlRfkndevlknieevleeilkal 108 + ++D e t L++ G+tvlRf+ ++v+kn+ +e++ + + VIMSS5767391 93 NIQRDIEVTGRLKAEGWTVLRFWSNDVVKNTTCCAEKVKEII 134 56899999***********************99999887765 PP
Or compare VIMSS5767391 to CDD or PaperBLAST