VIMSS5778754 has 61 amino acids
Query: DUF2065 [M=56]
Accession: PF09838.13
Description: Uncharacterized protein conserved in bacteria (DUF2065)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-21 60.5 8.1 7.3e-21 60.4 8.1 1.0 1 VIMSS5778754
Domain annotation for each sequence (and alignments):
>> VIMSS5778754
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.4 8.1 7.3e-21 7.3e-21 1 56 [] 4 59 .. 4 59 .. 0.98
Alignments for each domain:
== domain 1 score: 60.4 bits; conditional E-value: 7.3e-21
DUF2065 1 LllAlGLvLviEGllpflaPerwrrmlaqlaelpdgqLRliGlvsmllGllllwlv 56
L++A++Lv v+EGl++f+aP +w+rm ++l+ lp+ +LR +G++++l+Gl llw+v
VIMSS5778754 4 LFAAVCLVAVLEGLFLFVAPFAWKRMAERLLDLPSPALRSFGGLVLLAGLSLLWWV 59
789***************************************************97 PP
Or compare VIMSS5778754 to CDD or PaperBLAST