PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5782440 to PF01817 (CM_2)

VIMSS5782440 has 385 amino acids

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.3e-22   66.4   0.8    2.1e-22   65.7   0.8    1.4  1  VIMSS5782440  


Domain annotation for each sequence (and alignments):
>> VIMSS5782440  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.7   0.8   2.1e-22   2.1e-22       1      79 []      10      88 ..      10      88 .. 0.98

  Alignments for each domain:
  == domain 1  score: 65.7 bits;  conditional E-value: 2.1e-22
          CM_2  1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
                  R++I ++D+ell Lla+R +l+ e+a++K +++ p++d++Re+e+le l e+ ++ gld  ++ +if+ ii+ s+  Q+
  VIMSS5782440 10 RDKITALDSELLSLLAQRRQLSTEVAQFKLNTHRPIRDKNRERELLELLIEKGKNVGLDGFYISRIFQMIIEDSVLTQQ 88
                  99****************************9999*****************999********************99985 PP



Or compare VIMSS5782440 to CDD or PaperBLAST