VIMSS5783449 has 79 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-22 64.0 4.7 7e-22 63.4 4.7 1.3 1 VIMSS5783449
Domain annotation for each sequence (and alignments):
>> VIMSS5783449
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.4 4.7 7e-22 7e-22 1 47 [. 12 57 .. 12 58 .. 0.98
Alignments for each domain:
== domain 1 score: 63.4 bits; conditional E-value: 7e-22
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
sPCig C+ + +g+C+GC+R+++E++ Ws+ms++e+r+vl+ +++r
VIMSS5783449 12 SPCIGRCESN-LQGYCIGCYRSRQERFSWSTMSQQEKRNVLRLCRQR 57
9*********.***********************************9 PP
Or compare VIMSS5783449 to CDD or PaperBLAST