VIMSS5783775 has 192 amino acids
Query: DUF308 [M=73] Accession: PF03729.17 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-23 67.5 42.7 1.9e-15 43.2 18.5 3.0 3 VIMSS5783775 Domain annotation for each sequence (and alignments): >> VIMSS5783775 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 18.5 1.9e-15 1.9e-15 1 73 [] 26 98 .. 26 98 .. 0.98 2 ! 35.3 15.4 5.5e-13 5.5e-13 2 72 .. 85 154 .. 84 155 .. 0.94 3 ! 6.7 2.8 0.00048 0.00048 12 44 .. 153 185 .. 152 192 .] 0.78 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 1.9e-15 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllllf 73 ++++l +++Gi+++i+P+ +++++++++G+++++ +i++++aaf +r ++g++ + ll G +y+ +G+++++ VIMSS5783775 26 IIAVLGLLAGIICIINPFSSGVVVSVFLGIVFFACAITSIMAAFNSRISSGWSMLITLLAGFIYLFLGYIFIT 98 689*******************************************************************985 PP == domain 2 score: 35.3 bits; conditional E-value: 5.5e-13 DUF308 2 lGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllll 72 G +++ lG ++++ P+ +l l+++iG l++++Gi++lv +f++ k ++w+ +l+G l+++++++ll VIMSS5783775 85 AGFIYLFLGYIFITDPLNGMLSLAFIIGYLFIFAGILRLVLGFKQIK-DSFYGWFNILVGFLDLVLAYFLL 154 799****************************************6666.88999****************98 PP == domain 3 score: 6.7 bits; conditional E-value: 0.00048 DUF308 12 laliwPgaallalviliGvlllvsGivqlvaaf 44 l+ + P +++++++ liG+ l++s+i+ l a VIMSS5783775 153 LLAFGPETSITLVMALIGIQLILSSITILSIAS 185 66778999*****************98774444 PP
Or compare VIMSS5783775 to CDD or PaperBLAST