VIMSS5785594 has 55 amino acids
Query: DUF4223 [M=54]
Accession: PF13978.10
Description: Protein of unknown function (DUF4223)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.1e-33 98.9 1.5 6.5e-33 98.8 1.5 1.0 1 VIMSS5785594
Domain annotation for each sequence (and alignments):
>> VIMSS5785594
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.8 1.5 6.5e-33 6.5e-33 1 53 [. 1 53 [. 1 54 [. 0.98
Alignments for each domain:
== domain 1 score: 98.8 bits; conditional E-value: 6.5e-33
DUF4223 1 mkklvkvavvaavlatLtaCtGhienkkknCsYDYLlhPaisiskiiGGCGPi 53
mk +vk+a++a+ ++++t+CtG ++nk+k+C YDYLlhPa+siskiiGGCG +
VIMSS5785594 1 MKNFVKIALIASFVTVMTGCTGSVYNKEKDCNYDYLLHPAVSISKIIGGCGDT 53
99*************************************************76 PP
Or compare VIMSS5785594 to CDD or PaperBLAST