VIMSS5795936 has 79 amino acids
Query: DUF1480 [M=78]
Accession: PF07351.17
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.9e-48 146.6 0.0 9.8e-48 146.5 0.0 1.0 1 VIMSS5795936
Domain annotation for each sequence (and alignments):
>> VIMSS5795936
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 146.5 0.0 9.8e-48 9.8e-48 1 78 [] 1 78 [. 1 78 [. 0.99
Alignments for each domain:
== domain 1 score: 146.5 bits; conditional E-value: 9.8e-48
DUF1480 1 msktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
m kt +ri+afeidda+l++e gertl+iPcksdpdlcmqldawd+ets+Pailng++s+l+r hyd ++dawvmr+
VIMSS5795936 1 MMKTSVRIGAFEIDDAELHGESPGERTLTIPCKSDPDLCMQLDAWDAETSVPAILNGEHSVLFRTHYDPKSDAWVMRL 78
89**************************************************************************97 PP
Or compare VIMSS5795936 to CDD or PaperBLAST