VIMSS5796178 has 447 amino acids
Query: DUF1338 [M=169] Accession: PF07063.17 Description: Domain of unknown function (DUF1338), C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-70 221.5 0.0 7.7e-70 220.6 0.0 1.5 1 VIMSS5796178 Domain annotation for each sequence (and alignments): >> VIMSS5796178 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.6 0.0 7.7e-70 7.7e-70 2 169 .] 196 401 .. 195 401 .. 0.98 Alignments for each domain: == domain 1 score: 220.6 bits; conditional E-value: 7.7e-70 DUF1338 2 vsledyeeLkeeselaAdvvsfegyhiNHlTprvldidavqealeergiklkdeieGppkrspdilLrQtsfkAleeevefaeedgeeeegsvtarf 98 v++e+y++L++e++l+Advv+f g+hiNHlTpr+ldid+vq+++ e gi++k ieGpp+r+ +ilLrQtsfkAlee+v f d+ ++g++tarf VIMSS5796178 196 VDEETYRSLHREHRLIADVVCFPGCHINHLTPRTLDIDRVQAMMPECGITPKTLIEGPPRREVPILLRQTSFKALEEQVLFV--DE--KQGTHTARF 288 789*******************************************************************************..33..3579***** PP DUF1338 99 gEieqRgaaltpkGralydellkea...................fpddeeelrkegLayfr.......................ieeglveaepily 153 gEieqRg+altpkGr+lydell++a fpd+e lr++gLa+fr ie+g+v a+pi+y VIMSS5796178 289 GEIEQRGVALTPKGRRLYDELLHKAgtgkdnfthqlhlrevfnaFPDSEFLLRQQGLAWFRyrltpsgeahrqaihpgddpqplIERGWVIAQPITY 385 ************************************************************************************************* PP DUF1338 154 edFlpasAagIFesnl 169 edFlp+sAagIF+snl VIMSS5796178 386 EDFLPVSAAGIFQSNL 401 **************97 PP
Or compare VIMSS5796178 to CDD or PaperBLAST