VIMSS579934 has 200 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-32 95.9 0.3 6.5e-32 95.3 0.3 1.3 1 VIMSS579934
Domain annotation for each sequence (and alignments):
>> VIMSS579934
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 95.3 0.3 6.5e-32 6.5e-32 4 69 .] 58 123 .. 55 123 .. 0.97
Alignments for each domain:
== domain 1 score: 95.3 bits; conditional E-value: 6.5e-32
DUF374 4 rkkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGPr 69
k++i+++iS+++DGe+iar++ +g+kt+rGSss+g++r+l++++r+l+ G +iaiTpDGPrGP+
VIMSS579934 58 AKPRISVMISDHFDGEIIARMIGFFGFKTLRGSSSKGAKRVLLGAIRELEGGGDIAITPDGPRGPY 123
689**************************************************************5 PP
Or compare VIMSS579934 to CDD or PaperBLAST