VIMSS5800651 has 222 amino acids
Query: DUF3313 [M=186] Accession: PF11769.12 Description: Protein of unknown function (DUF3313) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-63 198.9 0.1 4.3e-63 198.7 0.1 1.0 1 VIMSS5800651 Domain annotation for each sequence (and alignments): >> VIMSS5800651 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 198.7 0.1 4.3e-63 4.3e-63 1 185 [. 30 213 .. 30 214 .. 0.99 Alignments for each domain: == domain 1 score: 198.7 bits; conditional E-value: 4.3e-63 DUF3313 1 kysgflsdYsgLkpesgakggavlryvdpgvdlakydkviiePvvlypgpdpeeklsaedlqllanyldraLkkeLskrfrlvaspgpgtLrvrlai 97 kysgfl++Ys L+++++a+g++vlr+vdp ++ ++yd+++++P+++yp p+p+++++++ l++l y++++ k+++++r++lv++pgp++L++r ai VIMSS5800651 30 KYSGFLKNYSDLQETTSATGKPVLRWVDPHFNDSNYDSIVYNPITYYPVPKPTTQVGQQVLDKLLAYTNTKVKSAIEQRKPLVTTPGPRSLIFRGAI 126 79**************************************************99******************************************* PP DUF3313 98 TgvkpttpvlatlsvllPiglvvnlvqaatgertgvGslaveaeitDavtgellaaavdkragnkintsarvsklsdakaaidkwadd 185 Tgv++++++l++++v+ P++l+v+++q+atg+rt++++l++e e++Da+t+++++++v++++g++++ s+++++++++k+++d++a+d VIMSS5800651 127 TGVDTSKEGLQFYEVI-PVALIVAGTQMATGHRTMDTHLYFEGELIDAATNKPVVKVVRQGEGKDLSNSSTPMAFETLKQVVDDMATD 213 ****************.*************************************************55******************97 PP
Or compare VIMSS5800651 to CDD or PaperBLAST