VIMSS58288 has 165 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-50 154.2 0.0 5.6e-50 154.0 0.0 1.1 1 VIMSS58288
Domain annotation for each sequence (and alignments):
>> VIMSS58288
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 154.0 0.0 5.6e-50 5.6e-50 1 107 [] 55 161 .. 55 161 .. 0.99
Alignments for each domain:
== domain 1 score: 154.0 bits; conditional E-value: 5.6e-50
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYqaa 99
gv+l++de++e++a dldr+++ia++fp+FtDGRg+S+arlLRer+gykge+rA+GdvlrDql++++rcGfda+++r+d+++e+a ++l++fs++Yq++
VIMSS58288 55 GVWLDADEEPESIAGDLDRFQVIAVNFPAFTDGRGFSSARLLRERYGYKGEIRAIGDVLRDQLFFMRRCGFDAYAIRADRSPEDALASLDDFSEVYQTS 153
8************************************************************************************************** PP
DUF934 100 vdeeqplf 107
v+++ plf
VIMSS58288 154 VEQPLPLF 161
*****997 PP
Or compare VIMSS58288 to CDD or PaperBLAST