VIMSS5835742 has 96 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-22 64.4 0.8 6.2e-22 64.1 0.8 1.1 1 VIMSS5835742
Domain annotation for each sequence (and alignments):
>> VIMSS5835742
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 64.1 0.8 6.2e-22 6.2e-22 1 79 [] 13 88 .. 13 88 .. 0.94
Alignments for each domain:
== domain 1 score: 64.1 bits; conditional E-value: 6.2e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+eId +D+el +Ll +R+e+a +ia +K+ + p++ p+Re+e+l+rl + ++l+ e+++ ++ e+++ sr++Q+
VIMSS5835742 13 RAEIDLLDNELSDLLDKRLEIALKIALIKQ--ESPIYCPKREQEILKRLSQRD-FKHLNGEILTGFYAEVFKISRKFQE 88
99***************************6..569****************43.578********************96 PP
Or compare VIMSS5835742 to CDD or PaperBLAST