VIMSS5848421 has 168 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.1e-43 130.8 0.2 1.2e-42 130.3 0.2 1.1 1 VIMSS5848421
Domain annotation for each sequence (and alignments):
>> VIMSS5848421
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 130.3 0.2 1.2e-42 1.2e-42 1 103 [. 57 159 .. 57 162 .. 0.98
Alignments for each domain:
== domain 1 score: 130.3 bits; conditional E-value: 1.2e-42
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYq 97
gv++++d++ve la dl+r+a++al+fpkF+DGR+y++arlLRer+gy+g +rAvGdvl++q+ +++rcGfdafe+++++++e ++ka +rf+++Yq
VIMSS5848421 57 GVRIEPDQEVEVLAYDLPRIAVVALAFPKFRDGRAYTSARLLRERFGYQGHIRAVGDVLQEQAGFMVRCGFDAFEPADGATPEVLTKAANRFRHVYQ 153
89*********************************************************************************************** PP
DUF934 98 aavdee 103
+a+d++
VIMSS5848421 154 RAADDR 159
***986 PP
Or compare VIMSS5848421 to CDD or PaperBLAST