VIMSS587850 has 70 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-20 58.6 3.2 2.6e-20 58.6 3.2 1.5 2 VIMSS587850
Domain annotation for each sequence (and alignments):
>> VIMSS587850
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.6 3.2 2.6e-20 2.6e-20 1 55 [. 4 58 .. 4 59 .. 0.98
2 ? -4.0 1.8 0.91 0.91 38 41 .. 64 67 .. 62 68 .. 0.85
Alignments for each domain:
== domain 1 score: 58.6 bits; conditional E-value: 2.6e-20
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllg 55
E++ +Gvy+p++l+ a++A+vl+ l++++ rl + +++ +p+ f+l+l+++ll+
VIMSS587850 4 EFNAYGVYIPSFLIQAICAFVLFKLVTLWTDRLIAKGWIGFPGVFNLSLYILLLM 58
89***************************************************97 PP
== domain 2 score: -4.0 bits; conditional E-value: 0.91
DUF1656 38 lvWh 41
++Wh
VIMSS587850 64 FIWH 67
8999 PP
Or compare VIMSS587850 to CDD or PaperBLAST