VIMSS590298 has 172 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-36 110.0 0.2 3.7e-36 109.5 0.2 1.3 1 VIMSS590298
Domain annotation for each sequence (and alignments):
>> VIMSS590298
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 109.5 0.2 3.7e-36 3.7e-36 3 105 .. 65 166 .. 63 168 .. 0.95
Alignments for each domain:
== domain 1 score: 109.5 bits; conditional E-value: 3.7e-36
DUF934 3 llasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYqaav 100
++ ++++e+++ ld+l+ i +ef+ F+DGRgyS a lLR r gy+gelrAvGd+++D l++lkr+Gfd+f+++e+kd+++a++ l++f++ Yqa++
VIMSS590298 65 YITVNDSPETHQFPLDQLDAIFIEFAGFNDGRGYSFAALLR-RQGYQGELRAVGDIFKDVLNYLKRSGFDTFVIKEGKDIQEAAAGLNDFRQPYQAST 161
67889999*********************************.55****************************************************99 PP
DUF934 101 deeqp 105
+ +q+
VIMSS590298 162 AVPQA 166
98775 PP
Or compare VIMSS590298 to CDD or PaperBLAST