VIMSS5915213 has 105 amino acids
Query: DUF202 [M=68]
Accession: PF02656.19
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.2e-20 57.2 2.9 9.2e-20 57.2 2.9 2.0 2 VIMSS5915213
Domain annotation for each sequence (and alignments):
>> VIMSS5915213
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.2 2.9 9.2e-20 9.2e-20 1 66 [. 6 69 .. 6 71 .. 0.96
2 ? 1.3 1.0 0.026 0.026 16 23 .. 90 97 .. 69 104 .. 0.52
Alignments for each domain:
== domain 1 score: 57.2 bits; conditional E-value: 9.2e-20
DUF202 1 rdglAnERTfLaWlRtslalialgvallrffleggptalalilglilivlgiltlllalvrylrre 66
++gl++ERT LaW Rt+++l+++++ llr+ ++ + +al+ ++il +++i++l++++vry r++
VIMSS5915213 6 DPGLQPERTVLAWNRTTVSLAVCSAILLRW--TNFYGIFALLPVVILSGMAIFILFTQRVRYERQA 69
79****************************..99999999**********************9975 PP
== domain 2 score: 1.3 bits; conditional E-value: 0.026
DUF202 16 tslalial 23
t la++a+
VIMSS5915213 90 TLLAFGAA 97
22222222 PP
Or compare VIMSS5915213 to CDD or PaperBLAST