PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5915956 to PF04341 (DUF485)

VIMSS5915956 has 113 amino acids

Query:       DUF485  [M=89]
Accession:   PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.7e-37  112.6   4.6    4.3e-37  112.3   4.6    1.1  1  VIMSS5915956  


Domain annotation for each sequence (and alignments):
>> VIMSS5915956  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  112.3   4.6   4.3e-37   4.3e-37       1      89 []      22     109 ..      22     109 .. 0.98

  Alignments for each domain:
  == domain 1  score: 112.3 bits;  conditional E-value: 4.3e-37
        DUF485   1 qaspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeire 89 
                   qasp+F eL++k+r+fafp+t++f+++Y+++vl+++fa +++at+v+ g+i++g+++g+lqfv+tfv+t++Yv +An++++p++++ir+
  VIMSS5915956  22 QASPEFGELRSKFRSFAFPMTVAFFLWYVVYVLVASFASEWMATPVF-GAINIGLIFGFLQFVTTFVITYIYVMFANKNLEPRQAAIRQ 109
                   689********************************************.***************************************96 PP



Or compare VIMSS5915956 to CDD or PaperBLAST