VIMSS5922662 has 110 amino acids
Query: DUF1508 [M=48] Accession: PF07411.16 Description: Domain of unknown function (DUF1508) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-46 140.5 2.1 2.4e-24 71.3 0.3 2.1 2 VIMSS5922662 Domain annotation for each sequence (and alignments): >> VIMSS5922662 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.3 0.3 2.4e-24 2.4e-24 1 48 [] 10 57 .. 10 57 .. 0.97 2 ! 69.3 0.1 9.8e-24 9.8e-24 2 48 .] 62 108 .. 61 108 .. 0.97 Alignments for each domain: == domain 1 score: 71.3 bits; conditional E-value: 2.4e-24 DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 ++nG+++F+Lk aNge+I++se Y+ k++a+ngI+sV+ nap +e+++ VIMSS5922662 10 ATNGQYYFHLKSANGEIILASERYEEKSGARNGIASVRDNAPLDERYE 57 579******************************************997 PP == domain 2 score: 69.3 bits; conditional E-value: 9.8e-24 DUF1508 2 knGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 nG+++F+LkaaN++vI+tse+Yss +a+engI+ Vk+ ap ae++D VIMSS5922662 62 HNGEPMFNLKAANHQVIGTSETYSSVQARENGIAAVKRDAPIAETVD 108 59******************************************997 PP
Or compare VIMSS5922662 to CDD or PaperBLAST