PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5923013 to PF04359 (DUF493)

VIMSS5923013 has 102 amino acids

Query:       DUF493  [M=84]
Accession:   PF04359.20
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.7e-36  109.9   0.0    4.5e-36  109.7   0.0    1.1  1  VIMSS5923013  


Domain annotation for each sequence (and alignments):
>> VIMSS5923013  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.7   0.0   4.5e-36   4.5e-36       1      84 []      19     102 .]      19     102 .] 0.98

  Alignments for each domain:
  == domain 1  score: 109.7 bits;  conditional E-value: 4.5e-36
        DUF493   1 eelleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84 
                   e+lleFPcdfpik++Gka++ef++++++vv+ h +e+d e++e r+Ss+g+Y+ +t+tv+++s+eqld+iyraL+ h++vk+vL
  VIMSS5923013  19 ESLLEFPCDFPIKIMGKAHPEFKDTIFKVVAVHDNEIDVEKIEERASSGGNYTGLTITVRATSQEQLDNIYRALTGHPMVKVVL 102
                   579*******************************************************************************98 PP



Or compare VIMSS5923013 to CDD or PaperBLAST